PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009622647.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 255aa    MW: 29328.4 Da    PI: 8.982
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009622647.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-171158148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l ++v+ +G g W+   ++ g++R++k+c++rw +yl
   XP_009622647.1 11 KGAWTKEEDEILMNYVQIHGVGKWNILCKKAGLNRCGKSCRLRWINYL 58
                     79********************************************97 PP

2Myb_DNA-binding54.82.2e-1764107146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++ eEd l+++++  lG++ W++Ia+ ++ gRt++++k++w++
   XP_009622647.1  64 RGNFSLEEDNLIINLHSSLGNK-WSKIASQLP-GRTDNEIKNHWNT 107
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.093658IPR017930Myb domain
SuperFamilySSF466897.4E-329105IPR009057Homeodomain-like
SMARTSM007173.3E-141060IPR001005SANT/Myb domain
PfamPF002491.6E-151158IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-241265IPR009057Homeodomain-like
CDDcd001671.12E-111358No hitNo description
PROSITE profilePS5129427.33159113IPR017930Myb domain
SMARTSM007177.4E-1663111IPR001005SANT/Myb domain
PfamPF002491.1E-1564107IPR001005SANT/Myb domain
CDDcd001672.19E-1266109No hitNo description
Gene3DG3DSA:1.10.10.601.9E-2666113IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MSSNNIRSLN KGAWTKEEDE ILMNYVQIHG VGKWNILCKK AGLNRCGKSC RLRWINYLRP  60
DIKRGNFSLE EDNLIINLHS SLGNKWSKIA SQLPGRTDNE IKNHWNTKLS KKLNLLGIDP  120
KTHKPIPNFC LINPLQVSPT LNMDNSTNPW TNLLDFTQLA RLQQLQFQTI LQTINNITSF  180
PSNLFMPNNY PIQDDMNRYY NYNNFIPDNS ETCFQGGLIS PEILNFNSIN PQTSTPNYQL  240
ASLPYLNTSP MCSFQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-30811324128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009622647.10.0PREDICTED: transcription repressor MYB6-like
TrEMBLA0A0S3R3A35e-62A0A0S3R3A3_PHAAN; Uncharacterized protein
TrEMBLA0A0L9TNE75e-62A0A0L9TNE7_PHAAN; Uncharacterized protein
STRINGVIT_16s0039g01710.t016e-59(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.21e-58myb domain protein 9